CacheBy
Atlas Antibodies Anti-TMPRSS15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMPRSS15 Antibody

상품 한눈에 보기

Human TMPRSS15 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Recombinant expression으로 검증되었으며, Rabbit에서 생산된 IgG 형식입니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015611-100 Anti-TMPRSS15 Antibody, transmembrane protease, serine 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015611-25 Anti-TMPRSS15 Antibody, transmembrane protease, serine 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMPRSS15 Antibody

Anti-TMPRSS15 Antibody

Target: transmembrane protease, serine 15 (TMPRSS15)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression)

Recombinant expression validation:
Validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human TMPRSS15


Alternative Gene Names

ENTK, MGC133046, PRSS7

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transmembrane protease, serine 15
Target Gene TMPRSS15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence INDVVEIRDGEEADSLLLAVYTGPGPVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVNLCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWT
Verified Species Reactivity Human
Interspecies Identity Mouse (75%), Rat (69%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.