CacheBy
Atlas Antibodies Anti-TMPRSS15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMPRSS15 Antibody

상품 한눈에 보기

Human TMPRSS15 단백질을 표적으로 하는 폴리클로날 래빗 항체로, IHC 및 WB 응용에 적합함. 재조합 발현 검증 완료. PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 마우스·랫과 교차 반응성 있음.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA072934-100 Anti-TMPRSS15 Antibody, transmembrane protease, serine 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072934-25 Anti-TMPRSS15 Antibody, transmembrane protease, serine 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMPRSS15 Antibody

Anti-TMPRSS15 Antibody

Target: transmembrane protease, serine 15
Type: Polyclonal Antibody against Human TMPRSS15

  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression

Alternative Gene Names

ENTK, MGC133046, PRSS7

Open Datasheet

Target Information

항목 내용
Target Protein transmembrane protease, serine 15
Target Gene TMPRSS15
Verified Species Reactivity Human
Interspecies Information Mouse (75%), Rat (69%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

INDVVEIRDGEEADSLLLAVYTGPGPVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVNLCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWT

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.