Atlas Antibodies Anti-TMPRSS2 Antibody

상품 한눈에 보기

Human TMPRSS2 단백질을 인식하는 고품질 Rabbit Polyclonal 항체로, IHC 및 WB 등 다양한 응용에 적합. Orthogonal validation을 통해 단백질 발현을 RNA-seq 데이터와 비교 검증. Affinity purification 방식으로 높은 특이성과 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035787-100 Anti-TMPRSS2 Antibody, transmembrane protease, serine 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035787-25 Anti-TMPRSS2 Antibody, transmembrane protease, serine 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TMPRSS2 Antibody

Anti-TMPRSS2 Antibody

Target: transmembrane protease, serine 2 (TMPRSS2)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human TMPRSS2

Alternative Gene Names

PRSS10

Target Information

항목	내용
Target Protein	transmembrane protease, serine 2
Target Gene	TMPRSS2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000000385 (66%), Rat ENSRNOG00000001976 (66%)

Antigen Sequence:
GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety	Material Safety Data Sheet