CacheBy
Atlas Antibodies Anti-TMPRSS15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMPRSS15 Antibody

상품 한눈에 보기

Human TMPRSS15 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며, ENTK/PRSS7 등 대체 유전자명 포함.

카탈로그번호
HPA034857-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034857-100 Anti-TMPRSS15 Antibody, transmembrane serine protease 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034857-25 Anti-TMPRSS15 Antibody, transmembrane serine protease 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMPRSS15 Antibody

Anti-TMPRSS15 Antibody

Target: transmembrane protease, serine 15 (TMPRSS15)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant expression validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human TMPRSS15


Alternative Gene Names

ENTK, MGC133046, PRSS7

Open Datasheet


Target Information

항목 내용
Target Protein transmembrane protease, serine 15
Target Gene TMPRSS15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence INDVVEIRDGEEADSLLLAVYTGPGPVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVNLCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWT
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000022857 (75%), Rat ENSRNOG00000001916 (69%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.