CacheBy
Atlas Antibodies Anti-TMPRSS11E Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMPRSS11E Antibody

상품 한눈에 보기

인간 TMPRSS11E 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 글리세롤 기반 완충액에 보존제로 나트륨 아지드 포함.

카탈로그번호
HPA051062-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051062-100 Anti-TMPRSS11E Antibody, transmembrane protease, serine 11E 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051062-25 Anti-TMPRSS11E Antibody, transmembrane protease, serine 11E 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMPRSS11E Antibody

Anti-TMPRSS11E Antibody

Target: transmembrane protease, serine 11E
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human TMPRSS11E.

Alternative Gene Names

  • DESC1
  • TMPRSS11E2

Target Information

항목 내용
Target Protein transmembrane protease, serine 11E
Target Gene TMPRSS11E
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000054537 (75%)
Rat ENSRNOG00000022255 (74%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Immunohistochemistry (IHC)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.