Atlas Antibodies Anti-TMEM231 Antibody

상품 한눈에 보기

Human TMEM231을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 사용 가능. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증됨. Affinity purification으로 높은 특이성과 재현성 확보. Human에 반응하며 Mouse, Rat과 89% 서열 유사성 보유.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042081-100 Anti-TMEM231 Antibody, transmembrane protein 231 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042081-25 Anti-TMEM231 Antibody, transmembrane protein 231 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TMEM231 Antibody

Anti-TMEM231 Antibody

Target: transmembrane protein 231 (TMEM231)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation)
WB (Western Blot)
ICC (Immunocytochemistry)

Orthogonal validation:
Protein expression verified using IHC by comparison to RNA-seq data of the corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human TMEM231

Alternative Gene Names

ALYE870, FLJ22167, JBTS20, MKS11, PRO1886

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	transmembrane protein 231
Target Gene	TMEM231
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVI
Verified Species Reactivity	Human
Interspecies Identity	Mouse (89%), Rat (89%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.