
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TMEM231 Antibody
상품 한눈에 보기
Human TMEM231을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 사용 가능. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증됨. Affinity purification으로 높은 특이성과 재현성 확보. Human에 반응하며 Mouse, Rat과 89% 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042081-100 Anti-TMEM231 Antibody, transmembrane protein 231 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042081-25 Anti-TMEM231 Antibody, transmembrane protein 231 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TMEM231 Antibody
Anti-TMEM231 Antibody
Target: transmembrane protein 231 (TMEM231)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation:
Protein expression verified using IHC by comparison to RNA-seq data of the corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human TMEM231
Alternative Gene Names
ALYE870, FLJ22167, JBTS20, MKS11, PRO1886
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transmembrane protein 231 |
| Target Gene | TMEM231 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVI |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (89%), Rat (89%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



