CacheBy
Atlas Antibodies Anti-TMEM223 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM223 Antibody

상품 한눈에 보기

Human TMEM223 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. IHC 및 ICC 적용 가능. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증된 반응성 보유. 최적 조건은 사용자에 의해 결정 필요.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014504-100 Anti-TMEM223 Antibody, transmembrane protein 223 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014504-25 Anti-TMEM223 Antibody, transmembrane protein 223 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM223 Antibody

Anti-TMEM223 Antibody

Target Information

  • Target Protein: Transmembrane protein 223
  • Target Gene: TMEM223
  • Alternative Gene Names: MGC3196
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TMEM223.

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    RSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSL

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000058002 100%
Mouse ENSMUSG00000010097 89%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Glycerol 40%
PBS pH 7.2
Sodium Azide 0.02% (preservative)

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.