CacheBy
Atlas Antibodies Anti-TMEM230 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM230 Antibody

상품 한눈에 보기

Human TMEM230 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 40% glycerol 기반 완충액에 보존제 포함. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061421-100 Anti-TMEM230 Antibody, transmembrane protein 230 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061421-25 Anti-TMEM230 Antibody, transmembrane protein 230 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM230 Antibody

Anti-TMEM230 Antibody

Target Information

  • Target Protein: transmembrane protein 230
  • Target Gene: TMEM230
  • Alternative Gene Names: C20orf30, HSPC274

Product Description

Polyclonal antibody against human TMEM230.
Recommended for use in immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    RWSLVLSPRLEPSGVISAHCNLHLLASSDSSASASRLCQRVMMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYK

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Identity:
    • Rat (ENSRNOG00000021263): 51%
    • Mouse (ENSMUSG00000027341): 48%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Usage Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.