CacheBy
Atlas Antibodies Anti-TMCO4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMCO4 Antibody

상품 한눈에 보기

Human TMCO4 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 특이적으로 반응하며 안정적인 PBS/glycerol buffer로 보존됩니다.

카탈로그번호
HPA014601-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014601-100 Anti-TMCO4 Antibody, transmembrane and coiled-coil domains 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014601-25 Anti-TMCO4 Antibody, transmembrane and coiled-coil domains 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMCO4 Antibody

Anti-TMCO4 Antibody

Target: Transmembrane and Coiled-Coil Domains 4 (TMCO4)
Supplier: Atlas Antibodies


Immunohistochemistry (IHC)


Product Description

Polyclonal antibody against Human TMCO4.


Alternative Gene Names

  • DKFZp686C23231

Open Datasheet


Target Information

항목 내용
Target Protein Transmembrane and Coiled-Coil Domains 4
Target Gene TMCO4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE

Species Reactivity

Verified Species Human

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000017401 (80%)
  • Mouse ENSMUSG00000041143 (78%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.