CacheBy
Atlas Antibodies Anti-TMCC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMCC2 Antibody

상품 한눈에 보기

Human TMCC2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석 및 RNA-seq 데이터 기반 정합 검증에 적합. 고순도 Affinity 정제 및 PrEST 항원 사용. 인체, 생쥐, 랫트 간 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA014254-100 Anti-TMCC2 Antibody, transmembrane and coiled-coil domain family 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014254-25 Anti-TMCC2 Antibody, transmembrane and coiled-coil domain family 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMCC2 Antibody

Anti-TMCC2 Antibody

Target: transmembrane and coiled-coil domain family 2 (TMCC2)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human TMCC2.


Alternative Gene Names

FLJ38497, HUCEP11

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transmembrane and coiled-coil domain family 2
Target Gene TMCC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AARALSGSATLVSSPKYGSDDECSSASASSAGAGSNSGAGPGGALGSPKSNALYGAPGNLDALLEELREIKEGQSHLEDSMEDLKTQLQRDYTYMTQCLQEER

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000042066 97%
Rat ENSRNOG00000000033 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.