CacheBy
Atlas Antibodies Anti-TMC8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMC8 Antibody

상품 한눈에 보기

Human TMC8 단백질을 인식하는 Rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합. EVER2, EVIN2 유전자와 관련된 연구용으로 사용. PrEST 항원을 이용해 친화 정제되었으며, PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA054429-100 Anti-TMC8 Antibody, transmembrane channel-like 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054429-25 Anti-TMC8 Antibody, transmembrane channel-like 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMC8 Antibody

Anti-TMC8 Antibody

Target: transmembrane channel-like 8 (TMC8)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human TMC8 protein.


Alternative Gene Names

  • EVER2
  • EVIN2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transmembrane channel-like 8
Target Gene TMC8
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence VQLENYPPNTEVNLTLIWCVVLKLASLGMFSVSLGQTILCIGRDKSSCESYGYNVCDYQCWENSVGEELYKLS

Verified Species Reactivity

  • Human

Interspecies Information

종 Ortholog ID 항원 서열 일치율
Mouse ENSMUSG00000050106 89%
Rat ENSRNOG00000046086 84%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.