CacheBy
Atlas Antibodies Anti-TMC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMC4 Antibody

상품 한눈에 보기

Human TMC4 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 제조됨. IHC 및 WB 실험에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. PBS 및 glycerol buffer에 보존제로 sodium azide 함유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA048635-100 Anti-TMC4 Antibody, transmembrane channel-like 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048635-25 Anti-TMC4 Antibody, transmembrane channel-like 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMC4 Antibody

Anti-TMC4 Antibody

Target: transmembrane channel-like 4 (TMC4)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human TMC4.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet


Target Information

항목 내용
Target Protein transmembrane channel-like 4
Target Gene TMC4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000059741 (56%), Mouse ENSMUSG00000019734 (55%)

Antigen Sequence:
EEDGGRSRKAFTEVTQTELQDPHPSRELPWPMQARRAHRQRNASRDQVVYGSGTKTDRWARLLRRSKEKTKEGLRSLQPWAWTLK


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.