CacheBy
Atlas Antibodies Anti-TMC6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMC6 Antibody

상품 한눈에 보기

Human TMC6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. EVER1/EVIN1 등의 대체 유전자명으로도 알려짐. PrEST 항원을 이용해 친화 정제됨. Human에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA051430-100 Anti-TMC6 Antibody, transmembrane channel-like 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051430-25 Anti-TMC6 Antibody, transmembrane channel-like 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMC6 Antibody

Anti-TMC6 Antibody

Target Protein: transmembrane channel-like 6 (TMC6)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human TMC6.


Alternative Gene Names

EVER1, EVIN1, LAK-4P

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transmembrane channel-like 6
Target Gene TMC6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000025572 (79%), Rat ENSRNOG00000053469 (44%)

Antigen Sequence:
YYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTALEEEEKQSLLVKELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRT


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.