CacheBy
Atlas Antibodies Anti-TLR4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TLR4 Antibody

상품 한눈에 보기

Human TLR4 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 글리세롤/PBS 완충액에 보존됩니다. 인간 특이적으로 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA049174-100 Anti-TLR4 Antibody, toll-like receptor 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049174-25 Anti-TLR4 Antibody, toll-like receptor 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TLR4 Antibody

Anti-TLR4 Antibody

Product Description

Polyclonal antibody against Human TLR4 (toll-like receptor 4).

면역조직화학 (IHC) 등 다양한 생명과학 연구용으로 권장됩니다.

Alternative Gene Names

ARMD10, CD284, hToll, TLR-4

Open Datasheet

Target Information

항목 내용
Target Protein Toll-like receptor 4
Target Gene TLR4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000039005 (64%), Rat ENSRNOG00000010522 (62%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Applications: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.