Atlas Antibodies Anti-TLR7 Antibody

상품 한눈에 보기

Human TLR7 단백질을 인식하는 토르 유사 수용체 7 항체로, Rabbit Polyclonal 형태입니다. IHC 등 단백질 발현 분석에 적합하며, RNA-seq 데이터 기반 정교한 Orthogonal 검증을 거쳤습니다. 고순도 Affinity 정제 및 안정화 버퍼 포함.

카탈로그번호: HPA059613-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA059613-100 Anti-TLR7 Antibody, toll-like receptor 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA059613-25 Anti-TLR7 Antibody, toll-like receptor 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TLR7 Antibody

Anti-TLR7 Antibody

Target: Toll-like receptor 7 (TLR7)
Type: Polyclonal Antibody against Human TLR7
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

This polyclonal antibody targets the human TLR7 protein. It has been validated using orthogonal methods and is suitable for immunohistochemistry (IHC) and related protein expression studies.

Open Datasheet (PDF)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNL

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Identity
Rat	ENSRNOG00000004249	80%
Mouse	ENSMUSG00000044583	78%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet