Atlas Antibodies Anti-TLN1 Antibody

상품 한눈에 보기

Human TLN1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. TLN1 발현을 Orthogonal validation으로 검증. 고순도의 Affinity purification 방식으로 제작되어 높은 특이성과 재현성을 제공.

카탈로그번호: HPA004748-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004748-100 Anti-TLN1 Antibody, talin 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004748-25 Anti-TLN1 Antibody, talin 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TLN1 Antibody

Anti-TLN1 Antibody (Atlas Antibodies)

Target Information

Target Protein: talin 1
Target Gene: TLN1
Alternative Gene Names: ILWEQ, TLN

Product Description

Polyclonal antibody against human TLN1, validated for multiple applications including IHC, WB, and ICC.

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB) — Orthogonal validation
Immunocytochemistry (ICC)

Orthogonal validation:
Protein expression verified using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
LLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSP

Species Reactivity

Verified Reactivity: Human
Interspecies Identity:
- Rat ENSRNOG00000016630 (100%)
- Mouse ENSMUSG00000028465 (99%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.