CacheBy
Atlas Antibodies Anti-THSD7B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-THSD7B Antibody

상품 한눈에 보기

인간 THSD7B 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합합니다. Rabbit에서 생산되었으며 IgG 아이소타입으로, 프레스트 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA056745-100 Anti-THSD7B Antibody, thrombospondin, type I, domain containing 7B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056745-25 Anti-THSD7B Antibody, thrombospondin, type I, domain containing 7B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-THSD7B Antibody

Anti-THSD7B Antibody

Target Protein: thrombospondin, type I, domain containing 7B
Target Gene: THSD7B
Alternative Gene Names: KIAA1679
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG

Product Description

Polyclonal antibody against Human THSD7B.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VLMESTGPAGHCPHLVESVPCEDPMCYRWLASEGICFPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPVPPPPERKSCEIPCRMDCVLSEW

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000003878 (90%)
  • Mouse ENSMUSG00000042581 (87%)

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Immunohistochemistry (IHC)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet

Specifications

항목 내용
제품명 Anti-THSD7B Antibody
공급업체 Atlas Antibodies
대상 단백질 thrombospondin, type I, domain containing 7B
유전자명 THSD7B
대체 유전자명 KIAA1679
클로날리티 Polyclonal
아이소타입 IgG
호스트 Rabbit
반응 종 Human
정제 방법 PrEST 항원 친화 정제
완충액 구성 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
권장 응용 IHC
주의사항 사용 전 부드럽게 혼합, 조건 최적화 필요

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.