
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-THSD7B Antibody
상품 한눈에 보기
인간 THSD7B 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤과 PBS 완충액에 보존되어 안정성이 우수합니다.
- 카탈로그번호
- HPA051416-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051416-100 Anti-THSD7B Antibody, thrombospondin, type I, domain containing 7B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051416-25 Anti-THSD7B Antibody, thrombospondin, type I, domain containing 7B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-THSD7B Antibody
Anti-THSD7B Antibody
Target: thrombospondin, type I, domain containing 7B (THSD7B)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human THSD7B.
Alternative Gene Names
- KIAA1679
Recommended Applications
- Immunohistochemistry (IHC)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | thrombospondin, type I, domain containing 7B |
| Target Gene | THSD7B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VLMESTGPAGHCPHLVESVPCEDPMCYRWLASEGICFPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPVPPPPERKSCEIPCRMDCVLSEW |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000003878 | 90% |
| Mouse | ENSMUSG00000042581 | 87% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



