Atlas Antibodies Anti-THSD7B Antibody

상품 한눈에 보기

인간 THSD7B 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤과 PBS 완충액에 보존되어 안정성이 우수합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051416-100 Anti-THSD7B Antibody, thrombospondin, type I, domain containing 7B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051416-25 Anti-THSD7B Antibody, thrombospondin, type I, domain containing 7B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: thrombospondin, type I, domain containing 7B (THSD7B)
Supplier: Atlas Antibodies

Polyclonal antibody against human THSD7B.

항목	내용
Target Protein	thrombospondin, type I, domain containing 7B
Target Gene	THSD7B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	VLMESTGPAGHCPHLVESVPCEDPMCYRWLASEGICFPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPVPPPPERKSCEIPCRMDCVLSEW

Species	Gene ID	Identity
Rat	ENSRNOG00000003878	90%
Mouse	ENSMUSG00000042581	87%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative)
MSDS	Material Safety Data Sheet