CacheBy
Atlas Antibodies Anti-THSD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-THSD1 Antibody

상품 한눈에 보기

인간 THSD1 단백질을 인식하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 친화성 정제된 고품질 Rabbit IgG. 인체 반응성 검증 및 주요 설치류와 82% 서열 동일성.

카탈로그번호
HPA012611-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012611-100 Anti-THSD1 Antibody, thrombospondin, type I, domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012611-25 Anti-THSD1 Antibody, thrombospondin, type I, domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-THSD1 Antibody

Anti-THSD1 Antibody

Target: thrombospondin, type I, domain containing 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human THSD1.


Alternative Gene Names

  • TMTSP

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein thrombospondin, type I, domain containing 1
Target Gene THSD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000012108 (82%), Mouse ENSMUSG00000031480 (82%)

Antigen Sequence:
VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQ


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.