CacheBy
Thermo Fisher Scientific CXCL12 alpha (SDF-1 alpha) Polyclonal Antibody, PeproTech
원본

Thermo Fisher Scientific CXCL12 alpha (SDF-1 alpha) Polyclonal Antibody, PeproTech

상품 한눈에 보기

Human CXCL12 alpha (SDF-1 alpha)에 특이적인 Rabbit Polyclonal Antibody로, Western blot, ELISA 등 다양한 응용에 적합. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 민감도를 제공. 연구용으로만 사용 가능.

카탈로그번호
500-P87A-xxx (3개 옵션)
판매단위
pk
카탈로그 보기

카탈로그

3개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 10:42
장비
Thermo Fisher Scientific 500-P87A-1MG CXCL12 alpha (SDF-1 alpha) Polyclonal Antibody, PeproTech 1 mg pk판매 단위 pk ·
재고 확인 필요
3,448,900원VAT 포함 3,793,790원
소모품
Thermo Fisher Scientific 500-P87A-100UG CXCL12 alpha (SDF-1 alpha) Polyclonal Antibody, PeproTech 100 ug pk판매 단위 pk ·
재고 확인 필요
411,600원VAT 포함 452,760원
Thermo Fisher Scientific 500-P87A-50UG CXCL12 alpha (SDF-1 alpha) Polyclonal Antibody, PeproTech 50 ug pk판매 단위 pk ·
재고 확인 필요
328,500원VAT 포함 361,350원

Thermo Fisher Scientific · Thermo Fisher Scientific CXCL12 alpha (SDF-1 alpha) Polyclonal Antibody, PeproTech

Thermo Fisher Scientific CXCL12 alpha (SDF-1 alpha) Polyclonal Antibody, PeproTech

Applications and Tested Dilution

Application Tested Dilution Publications
Western Blot (WB) 0.1–0.2 µg/mL View 4 publications
Immunocytochemistry (ICC/IF) View 1 publication
Flow Cytometry (Flow) View 1 publication
ELISA 0.5–2.0 µg/mL View 3 publications
Neutralization (Neu) View 2 publications
In vitro Assay (IV) View 2 publications
Miscellaneous PubMed (Misc) View 1 publication
Immunostaining (IS) View 7 publications

Product Specifications

Specification Description
Species Reactivity Human
Published Species Human, Mouse, Rat
Host/Isotype Rabbit
Class Polyclonal
Type Antibody
Immunogen E.coli-derived Recombinant Human SDF-1alpha (CXCL12)
Conjugate Unconjugated
Form Lyophilized
Concentration 0.1–1.0 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS
Contains No preservative
Storage Conditions −20°C
Shipping Conditions Ambient
RRID AB_2930821

Product Specific Information

  • AA Sequence of recombinant protein:
    KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

  • Preparation:
    Produced from sera of rabbits immunized with highly pure Recombinant Human SDF-1alpha (CXCL12). The antibody was purified by affinity chromatography employing an immobilized Human SDF-1alpha (CXCL12) matrix.

  • Sandwich ELISA:
    For detection of Human SDF-1alpha (CXCL12) by sandwich ELISA, use 0.5–2.0 µg/mL antibody (100 µL/well). In conjunction with PeproTech Biotinylated Anti-Human SDF-1alpha (CXCL12) (500-P87ABt) as detection antibody, it detects ≥0.2–0.4 ng/well of Recombinant Human SDF-1alpha.

  • Western Blot:
    For detection of Human SDF-1alpha by Western Blot, use 0.1–0.2 µg/mL antibody. Detection limit for Recombinant Human SDF-1alpha is 1.5–3.0 ng/lane under reducing or non-reducing conditions.


Target Information

CXCL12 is a stromal cell-derived alpha chemokine member of the intercrine family. Together with its receptor CXCR4, it activates lymphocytes and is implicated in cancer metastasis such as breast cancer. Mutations in CXCL12 are associated with resistance to HIV-1 infection. Multiple transcript variants encoding different isoforms have been identified.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 파일명: 500-P87A-100UG_CXCL12_alpha_P48061-1_Rabbit.svg, 500-P87A-100UG_CXCL12_alpha_P48061-1_Rabbit_PDP.jpeg)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.