CacheBy
Atlas Antibodies Anti-TFAP2C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TFAP2C Antibody

상품 한눈에 보기

인간 TFAP2C 단백질을 인식하는 고품질 폴리클로날 항체입니다. IHC 및 ICC 등 다양한 응용에 적합하며, RNA-seq 데이터와 비교한 정교한 오쏘고날 검증을 제공합니다. 친화 정제된 토끼 IgG로 높은 특이성과 재현성을 보장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA057076-100 Anti-TFAP2C Antibody, transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057076-25 Anti-TFAP2C Antibody, transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TFAP2C Antibody

Anti-TFAP2C Antibody

Target: Transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)
  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues

Product Description

Polyclonal Antibody against Human TFAP2C


Alternative Gene Names

AP2-GAMMA, ERF1, hAP-2g, TFAP2G

Open Datasheet


Target Information

항목 내용
Target Protein transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
Target Gene TFAP2C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000005246 (87%), Mouse ENSMUSG00000028640 (85%)

Antigen Sequence:
RSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTE


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.