CacheBy
Atlas Antibodies Anti-TFAP2D Antibody
원본

Atlas Antibodies Anti-TFAP2D Antibody

상품 한눈에 보기

Human TFAP2D 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 기반 완충액에 보존되어 안정성이 우수합니다.

카탈로그번호
HPA048962-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048962-100 Anti-TFAP2D Antibody, transcription factor AP-2 delta (activating enhancer binding protein 2 delta) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048962-25 Anti-TFAP2D Antibody, transcription factor AP-2 delta (activating enhancer binding protein 2 delta) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TFAP2D Antibody

Anti-TFAP2D Antibody

Target: transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human TFAP2D, targeting transcription factor AP-2 delta (activating enhancer binding protein 2 delta).


Alternative Gene Names

  • TFAP2BL1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
Target Gene TFAP2D
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRKTSEAAVKEGK
Verified Species Reactivity Human
Ortholog Identity Rat ENSRNOG00000011642 (98%), Mouse ENSMUSG00000042596 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.