CacheBy
Atlas Antibodies Anti-TFAP2C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TFAP2C Antibody

상품 한눈에 보기

인간 TFAP2C 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 정제된 토끼 IgG 형식입니다. RNA-seq 기반 정교한 정합 검증을 통해 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA055179-100 Anti-TFAP2C Antibody, transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055179-25 Anti-TFAP2C Antibody, transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TFAP2C Antibody

Anti-TFAP2C Antibody

Target: transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)


  • IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human TFAP2C.


Alternative Gene Names

AP2-GAMMA, ERF1, hAP-2g, TFAP2G

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
Target Gene TFAP2C
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence RSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTE
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000005246 (87%), Mouse ENSMUSG00000028640 (85%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.