CacheBy
Atlas Antibodies Anti-TEX40 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TEX40 Antibody

상품 한눈에 보기

Human TEX40 단백질을 인식하는 토끼 폴리클로날 항체로, testis expressed 40 단백질 연구용으로 적합함. ICC 등 다양한 응용 가능. PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증됨.

카탈로그번호
HPA052822-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052822-100 Anti-TEX40 Antibody, testis expressed 40 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052822-25 Anti-TEX40 Antibody, testis expressed 40 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TEX40 Antibody

Anti-TEX40 Antibody

Target Information

  • Target Protein: testis expressed 40
  • Target Gene: TEX40
  • Alternative Gene Names: C11orf20, DKFZP566E164

Product Description

Polyclonal antibody against human TEX40 protein. Suitable for various immunoassay applications.

  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000051621 (70%)
  • Mouse ENSMUSG00000050623 (70%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.