CacheBy
Atlas Antibodies Anti-TCEAL7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCEAL7 Antibody

상품 한눈에 보기

Human TCEAL7 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생성된 IgG 형식입니다. IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 단백질 발현을 확인할 수 있습니다. Affinity purification 방식으로 고순도 확보, PBS/glycerol buffer에 보존되어 있습니다.

카탈로그번호
HPA065080-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065080-100 Anti-TCEAL7 Antibody, transcription elongation factor A (SII)-like 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065080-25 Anti-TCEAL7 Antibody, transcription elongation factor A (SII)-like 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCEAL7 Antibody

Anti-TCEAL7 Antibody

transcription elongation factor A (SII)-like 7

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human TCEAL7

Alternative Gene Names

MGC23947, WEX5

Open Datasheet

Target Information

항목 내용
Target Protein transcription elongation factor A (SII)-like 7
Target Gene TCEAL7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000037645 (81%), Mouse ENSMUSG00000079428 (79%)

Antigen Sequence:

FKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.