CacheBy
Atlas Antibodies Anti-TCEAL5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TCEAL5 Antibody

상품 한눈에 보기

Human TCEAL5 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, IHC 등 다양한 응용에 적합합니다. Human에 대한 검증된 반응성을 제공합니다.

카탈로그번호
HPA045564-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045564-100 Anti-TCEAL5 Antibody, transcription elongation factor A (SII)-like 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045564-25 Anti-TCEAL5 Antibody, transcription elongation factor A (SII)-like 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TCEAL5 Antibody

Anti-TCEAL5 Antibody

Target: transcription elongation factor A (SII)-like 5
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human TCEAL5, designed for reliable detection of the transcription elongation factor A (SII)-like 5 protein.


Alternative Gene Names

  • WEX4

Target Information

항목 내용
Target Protein transcription elongation factor A (SII)-like 5
Target Gene TCEAL5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000044550 (82%), Rat ENSRNOG00000046280 (79%)

Antigen Sequence:
PKDSQEDLQERHLSSEEMMRECGDVSRAQEELRK


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet


제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.