CacheBy
Atlas Antibodies Anti-TBCD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TBCD Antibody

상품 한눈에 보기

Human TBCD 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 Affinity 정제됨. Human에 대한 반응성이 검증되었으며, Rat 및 Mouse와 95% 동일성. PBS/glycerol buffer에 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045200-100 Anti-TBCD Antibody, tubulin folding cofactor D 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045200-25 Anti-TBCD Antibody, tubulin folding cofactor D 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TBCD Antibody

Anti-TBCD Antibody

Target: tubulin folding cofactor D

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human TBCD.
Open Datasheet (PDF)

Target Information

항목 내용
Target Protein tubulin folding cofactor D
Target Gene TBCD
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence FQETDKAWHGGCLALAELGRRGLLLPSRLVDVVAVILKALTYDEKRGACSVGTNVRDAACYVCWAFARAYEPQELKPFVTAISSALVIAAVFDRDINCRRAASAAFQENVGRQGTFPHGIDILTTADYFAVGN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000036658): 95%
  • Mouse (ENSMUSG00000039230): 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.