CacheBy
Atlas Antibodies Anti-TBCE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TBCE Antibody

상품 한눈에 보기

Human TBCE 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공. 인체 조직 및 단백질 발현 연구에 적합.

카탈로그번호
HPA026557-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026557-100 Anti-TBCE Antibody, tubulin folding cofactor E 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026557-25 Anti-TBCE Antibody, tubulin folding cofactor E 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TBCE Antibody

Anti-TBCE Antibody

Target: tubulin folding cofactor E

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
    • Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human TBCE

Alternative Gene Names

HRD, KCS, KCS1, pac2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein tubulin folding cofactor E
Target Gene TBCE
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ERGKHDGSHEGTVYFKCRHPTGGSFIRPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDSIMKQQSQLSKLQEVSLRNCAVSCAGE

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID Sequence Identity
Rat ENSRNOG00000029667 71%
Mouse ENSMUSG00000039233 71%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Tooltip Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.