Atlas Antibodies Anti-TBCB Antibody

상품 한눈에 보기

Human TBCB 단백질을 인식하는 폴리클로날 항체로, WB 및 IHC에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원을 이용해 친화 정제되었습니다. Human, Mouse, Rat에서 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041722-100 Anti-TBCB Antibody, tubulin folding cofactor B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041722-25 Anti-TBCB Antibody, tubulin folding cofactor B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

tubulin folding cofactor B

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human TBCB

CG22, CKAP1, CKAPI

항목	내용
Target Protein	tubulin folding cofactor B
Target Gene	TBCB
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	RVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKP
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000045655 (83%), Mouse ENSMUSG00000006095 (82%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand