Atlas Antibodies Anti-TBCC Antibody

상품 한눈에 보기

Human TBCC 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. siRNA knockdown으로 유전적 검증 완료. Rabbit 호스트에서 생산되었으며, PrEST 항원을 이용해 친화 정제됨. 고순도 및 안정적 보존용 버퍼 포함.

카탈로그번호: HPA035073-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035073-100 Anti-TBCC Antibody, tubulin folding cofactor C 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035073-25 Anti-TBCC Antibody, tubulin folding cofactor C 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TBCC Antibody

Anti-TBCC Antibody

Target: Tubulin folding cofactor C (TBCC)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Genetic validation: Verified in WB by siRNA knockdown.

Product Description

Polyclonal antibody against human TBCC.

Alternative Gene Names

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	Tubulin folding cofactor C
Target Gene	TBCC
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (64%), Rat (62%)

Antigen Sequence:
GLQKLINDSVFFLAAYDLRQGQEALARLQAALAERRRGLQPKKRFAFKTRGKDAASSTKVDAAPGIPPAVESIQDS

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand