CacheBy
Atlas Antibodies Anti-TACC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TACC2 Antibody

상품 한눈에 보기

인간 TACC2 단백질에 대한 고품질 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061394-100 Anti-TACC2 Antibody, transforming, acidic coiled-coil containing protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061394-25 Anti-TACC2 Antibody, transforming, acidic coiled-coil containing protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TACC2 Antibody

Anti-TACC2 Antibody

Transforming, acidic coiled-coil containing protein 2


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human TACC2.


Alternative Gene Names

  • AZU-1

Open Datasheet


Target Information

항목 내용
Target Protein transforming, acidic coiled-coil containing protein 2
Target Gene TACC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030852 (45%), Rat ENSRNOG00000020457 (41%)

Antigen Sequence

NLPTHGGQEQALGSELQSQLPKGTLSDTPTSSPTDMVWESSLTEESELSAPTRQKLPALGEKRPEGACGDGQSSRVSPPAADVLKDFSLAGNFS

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.