Atlas Antibodies Anti-TACC2 Antibody

상품 한눈에 보기

Human TACC2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC를 포함한 단백질 발현 분석에 적합합니다. PrEST 항원으로 특이 정제되었으며, RNA-seq 데이터 기반 Orthogonal 검증 완료. Human 반응성 검증 및 고순도 IgG 포맷.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031021-100 Anti-TACC2 Antibody, transforming, acidic coiled-coil containing protein 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031021-25 Anti-TACC2 Antibody, transforming, acidic coiled-coil containing protein 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TACC2 Antibody

Anti-TACC2 Antibody

Target: transforming, acidic coiled-coil containing protein 2 (TACC2)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human TACC2.

Alternative Gene Names

AZU-1

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	transforming, acidic coiled-coil containing protein 2
Target Gene	TACC2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	NLPTHGGQEQALGSELQSQLPKGTLSDTPTSSPTDMVWESSLTEESELSAPTRQKLPALGEKRPEGACGDGQSSRVSPPAADVLKDFSLAGNFS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

Mouse ENSMUSG00000030852 (45%)
Rat ENSRNOG00000020457 (41%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet