
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TACC2 Antibody
상품 한눈에 보기
Human TACC2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC를 포함한 단백질 발현 분석에 적합합니다. PrEST 항원으로 특이 정제되었으며, RNA-seq 데이터 기반 Orthogonal 검증 완료. Human 반응성 검증 및 고순도 IgG 포맷.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031021-100 Anti-TACC2 Antibody, transforming, acidic coiled-coil containing protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031021-25 Anti-TACC2 Antibody, transforming, acidic coiled-coil containing protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TACC2 Antibody
Anti-TACC2 Antibody
Target: transforming, acidic coiled-coil containing protein 2 (TACC2)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human TACC2.
Alternative Gene Names
- AZU-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transforming, acidic coiled-coil containing protein 2 |
| Target Gene | TACC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NLPTHGGQEQALGSELQSQLPKGTLSDTPTSSPTDMVWESSLTEESELSAPTRQKLPALGEKRPEGACGDGQSSRVSPPAADVLKDFSLAGNFS |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse ENSMUSG00000030852 (45%)
- Rat ENSRNOG00000020457 (41%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



