CacheBy
Atlas Antibodies Anti-STX10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STX10 Antibody

상품 한눈에 보기

인간 STX10 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. 면역조직화학(IHC) 등 다양한 연구 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. PBS 및 글리세롤 기반 버퍼로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056439-100 Anti-STX10 Antibody, syntaxin 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056439-25 Anti-STX10 Antibody, syntaxin 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STX10 Antibody

Anti-STX10 Antibody

Target Information

  • Target Protein: syntaxin 10
  • Target Gene: STX10
  • Alternative Gene Names: hsyn10, SYN10

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human STX10

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000026470 (40%)
  • Rat ENSRNOG00000003402 (40%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage & Handling Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.