CacheBy
Atlas Antibodies Anti-STUB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STUB1 Antibody

상품 한눈에 보기

Human STUB1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 응용에 적합. Affinity purification 방식으로 높은 특이성과 재현성을 제공. CHIP, HSPABP2 등 다양한 유전자명으로 알려진 STUB1 단백질 검출에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043531-100 Anti-STUB1 Antibody, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043531-25 Anti-STUB1 Antibody, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STUB1 Antibody

Anti-STUB1 Antibody

STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase


  • IHC (Independent Antibody Validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human STUB1


Alternative Gene Names

CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1


Target Information

항목 내용
Target Protein STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
Target Gene STUB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000039615 (100%), Rat ENSRNOG00000019798 (100%)

Antigen Sequence:

CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.