Atlas Antibodies Anti-STX12 Antibody

상품 한눈에 보기

Human STX12 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. STX13, STX14 대체 유전자명으로 알려져 있으며 Human, Mouse, Rat에서 반응성이 검증되었습니다. PrEST 항원을 이용해 친화 정제되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041038-100 Anti-STX12 Antibody, syntaxin 12 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041038-25 Anti-STX12 Antibody, syntaxin 12 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-STX12 Antibody

Anti-STX12 Antibody

Target Information

Target Protein: syntaxin 12
Target Gene: STX12
Alternative Gene Names: STX13, STX14

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot)

Product Description

Polyclonal antibody against Human STX12.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MSYGPLDVYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKE

Verified Species Reactivity

Human
Mouse
Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000028879	96%
Rat	ENSRNOG00000011804	95%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand