Atlas Antibodies Anti-STIP1 Antibody

상품 한눈에 보기

인간 STIP1 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 Independent 검증으로 높은 신뢰성을 보장하며, Rabbit IgG 기반으로 PrEST 항원 친화 정제되었습니다. Human 반응성 확인.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044062-100 Anti-STIP1 Antibody, stress-induced phosphoprotein 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044062-25 Anti-STIP1 Antibody, stress-induced phosphoprotein 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-STIP1 Antibody

Anti-STIP1 Antibody

Target Protein: stress-induced phosphoprotein 1
Supplier: Atlas Antibodies

Recommended Applications

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal Antibody against Human STIP1

Alternative Gene Names: HOP, STI1
Target Gene: STIP1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMD

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000021164	95%
Mouse	ENSMUSG00000024966	94%

Antibody Specifications

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand