CacheBy
Atlas Antibodies Anti-STAT5A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STAT5A Antibody

상품 한눈에 보기

Human STAT5A 단백질을 인식하는 Rabbit Polyclonal 항체. IHC, WB, ICC에 적합하며 Human, Mouse, Rat에 반응. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042128-100 Anti-STAT5A Antibody, signal transducer and activator of transcription 5A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042128-25 Anti-STAT5A Antibody, signal transducer and activator of transcription 5A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STAT5A Antibody

Anti-STAT5A Antibody

Signal Transducer and Activator of Transcription 5A

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human STAT5A.

Alternative Gene Names

MGF, STAT5

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Signal transducer and activator of transcription 5A
Target Gene STAT5A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS
Verified Species Reactivity Human, Mouse, Rat
Interspecies Homology Rat ENSRNOG00000019496 (93%), Mouse ENSMUSG00000004043 (91%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.