CacheBy
Atlas Antibodies Anti-STAT5A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STAT5A Antibody

상품 한눈에 보기

인간 STAT5A 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 토끼 유래 IgG 항체이며, 인간·마우스·랫트 반응성 검증 완료. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049883-100 Anti-STAT5A Antibody, signal transducer and activator of transcription 5A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049883-25 Anti-STAT5A Antibody, signal transducer and activator of transcription 5A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STAT5A Antibody

Anti-STAT5A Antibody

Signal transducer and activator of transcription 5A

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human STAT5A.

Alternative Gene Names

MGF, STAT5

Open Datasheet

Target Information

항목 내용
Target Protein Signal transducer and activator of transcription 5A
Target Gene STAT5A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000019496 (93%), Mouse ENSMUSG00000004043 (91%)

Antigen Sequence:
YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.