Atlas Antibodies Anti-STAT1 Antibody

상품 한눈에 보기

휴먼 STAT1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 정제되었으며, 정제된 토끼 IgG 형식입니다. RNA-seq 데이터 기반의 직교 검증을 통해 높은 특이성과 신뢰성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA000982-100 Anti-STAT1 Antibody, signal transducer and activator of transcription 1, 91kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA000982-25 Anti-STAT1 Antibody, signal transducer and activator of transcription 1, 91kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

signal transducer and activator of transcription 1, 91kDa

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody against Human STAT1

ISGF-3, STAT91

항목	내용
Target Protein	signal transducer and activator of transcription 1, 91kDa
Target Gene	STAT1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	FQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA

Human

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000014079	87%
Mouse	ENSMUSG00000026104	86%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand