
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPPL3 Antibody
상품 한눈에 보기
Human SPPL3 단백질을 인식하는 rabbit polyclonal antibody로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 정제되었으며, 높은 종간 보존성을 가짐. 40% glycerol/PBS buffer에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059958-100 Anti-SPPL3 Antibody, signal peptide peptidase like 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059958-25 Anti-SPPL3 Antibody, signal peptide peptidase like 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPPL3 Antibody
Anti-SPPL3 Antibody
Target Information
- Target Protein: Signal peptide peptidase like 3
- Target Gene: SPPL3
- Alternative Gene Names: DKFZP586C1324, IMP2, MGC126674, MGC126676, MGC90402, PSL4
Product Description
Polyclonal antibody against human SPPL3, produced in rabbit. Suitable for immunocytochemistry and other applications.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:FNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTG
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000001178 (100%)
- Mouse ENSMUSG00000029550 (100%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
Immunocytochemistry (ICC)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



