Atlas Antibodies Anti-SPPL3 Antibody

상품 한눈에 보기

Human SPPL3 단백질을 인식하는 rabbit polyclonal antibody로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 정제되었으며, 높은 종간 보존성을 가짐. 40% glycerol/PBS buffer에 보존제 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA059958-100 Anti-SPPL3 Antibody, signal peptide peptidase like 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA059958-25 Anti-SPPL3 Antibody, signal peptide peptidase like 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Signal peptide peptidase like 3
Target Gene: SPPL3
Alternative Gene Names: DKFZP586C1324, IMP2, MGC126674, MGC126676, MGC90402, PSL4

Polyclonal antibody against human SPPL3, produced in rabbit. Suitable for immunocytochemistry and other applications.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
FNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTG

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand