CacheBy
Atlas Antibodies Anti-SPR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPR Antibody

상품 한눈에 보기

인간 SPR 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. PBS/glycerol 버퍼에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039505-100 Anti-SPR Antibody, sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039505-25 Anti-SPR Antibody, sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPR Antibody

Anti-SPR Antibody

Target Information

  • Target Protein: sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
  • Target Gene: SPR
  • Alternative Gene Names: SDR38C1

Product Description

Polyclonal antibody against human SPR.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFY

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000033735): 74%
  • Rat (ENSRNOG00000028235): 73%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications IHC, WB, ICC
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

자료 링크

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.