CacheBy
Atlas Antibodies Anti-SPPL3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPPL3 Antibody

상품 한눈에 보기

Human SPPL3 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 40% 글리세롤 기반 PBS 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004194-100 Anti-SPPL3 Antibody, signal peptide peptidase like 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004194-25 Anti-SPPL3 Antibody, signal peptide peptidase like 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPPL3 Antibody

Anti-SPPL3 Antibody

Signal peptide peptidase like 3 (SPPL3)


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SPPL3.


Alternative Gene Names

DKFZP586C1324, IMP2, MGC126674, MGC126676, MGC90402, PSL4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Signal peptide peptidase like 3
Target Gene SPPL3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTG
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000029550 (100%), Rat ENSRNOG00000001178 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.