
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPOCK2 Antibody
상품 한눈에 보기
Human SPOCK2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 제공. 다양한 종 간 교차 반응성 정보 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044605-100 Anti-SPOCK2 Antibody, sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044605-25 Anti-SPOCK2 Antibody, sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPOCK2 Antibody
Anti-SPOCK2 Antibody
Target: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2
Type: Polyclonal Antibody against Human SPOCK2
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody developed in rabbit targeting human SPOCK2 protein.
Alternative Gene Names
- KIAA0275
- Testican-2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2 |
| Target Gene | SPOCK2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000058297 | 86% |
| Rat | ENSRNOG00000061544 | 85% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



