CacheBy
Atlas Antibodies Anti-SPON1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPON1 Antibody

상품 한눈에 보기

인간 SPON1 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합합니다. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 높은 종간 반응성(마우스·랫 97%)을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077546-100 Anti-SPON1 Antibody, spondin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077546-25 Anti-SPON1 Antibody, spondin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPON1 Antibody

Anti-SPON1 Antibody

Target Information

  • Target Protein: spondin 1
  • Target Gene: SPON1
  • Alternative Gene Names: f-spondin, KIAA0762

Product Description

Polyclonal antibody against human SPON1. Recommended for immunohistochemistry (IHC) and related applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000038156): 97%
  • Rat (ENSRNOG00000058003): 97%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.