Atlas Antibodies Anti-SPON2 Antibody

상품 한눈에 보기

인간 SPON2 단백질을 표적으로 하는 폴리클로날 항체로, 면역조직화학(IHC) 및 웨스턴 블롯(WB)에서 사용 가능. 재조합 단백질 발현 검증 완료. 친화성 정제된 고순도 항체로 안정적인 반응성과 높은 특이성을 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040170-100 Anti-SPON2 Antibody, spondin 2, extracellular matrix protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040170-25 Anti-SPON2 Antibody, spondin 2, extracellular matrix protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: spondin 2, extracellular matrix protein
Type: Polyclonal Antibody against Human SPON2
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)
Western Blot (WB)
Recombinant expression validation in WB using target protein overexpression.

항목	내용
Target Protein	spondin 2, extracellular matrix protein
Target Gene	SPON2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000006033 (84%), Mouse ENSMUSG00000037379 (83%)

Antigen Sequence:

HPANSFYYPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGS

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand