AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPATA2 Antibody
상품 한눈에 보기
인간 SPATA2 단백질을 인식하는 토끼 유래 폴리클로날 항체. 정자형성과 관련된 단백질 연구에 적합. IHC 등 다양한 응용 가능. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048581-100 Anti-SPATA2 Antibody, spermatogenesis associated 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048581-25 Anti-SPATA2 Antibody, spermatogenesis associated 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPATA2 Antibody
Anti-SPATA2 Antibody
Target Information
- Target Protein: spermatogenesis associated 2
- Target Gene: SPATA2
- Alternative Gene Names: KIAA0757, PD1, PPP1R145, tamo
Recommended Applications
면역조직화학(IHC) 등 다양한 생물학적 분석에 사용 가능
Product Description
- Type: Polyclonal Antibody
- Host: Rabbit
- Isotype: IgG
- Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Purification Method: Affinity purified using the PrEST antigen as affinity ligand
Antigen Sequence
TYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPAS
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000047030 | 88% |
| Rat | ENSRNOG00000009207 | 85% |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.