
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SPATA17 Antibody
상품 한눈에 보기
인간 SPATA17 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 실험에 적합. 정제된 PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 반응하며 생식세포 관련 연구에 유용.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030099-100 Anti-SPATA17 Antibody, spermatogenesis associated 17 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030099-25 Anti-SPATA17 Antibody, spermatogenesis associated 17 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SPATA17 Antibody
Anti-SPATA17 Antibody
Target Protein: spermatogenesis associated 17
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated using IHC compared to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant expression validation): Verified by recombinant overexpression of the target protein.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human SPATA17.
Alternative Gene Names: IQCH
Target Gene: SPATA17
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KEPDPWELQLQKAKPLTHRRPKVKQKDSTSLTDWLACTSARSFPRSEILPPINRKQCQGPFRDITEVLEQRYRPLEPTLRVAEPIDEL
Specifications
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000002504 (73%), Mouse ENSMUSG00000026611 (71%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Information | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



