CacheBy
Atlas Antibodies Anti-SPATA19 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPATA19 Antibody

상품 한눈에 보기

Human SPATA19 단백질을 타깃으로 하는 토끼 폴리클로날 항체. IHC 기반 정량 검증 수행. 정제된 PrEST 항원 사용으로 높은 특이성과 재현성 제공. 생식세포 발현 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040082-100 Anti-SPATA19 Antibody, spermatogenesis associated 19 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040082-25 Anti-SPATA19 Antibody, spermatogenesis associated 19 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPATA19 Antibody

Anti-SPATA19 Antibody

Target: spermatogenesis associated 19 (SPATA19)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human SPATA19.


Alternative Gene Names

CT132, FLJ25851, SPAS1, spergen1

Open Datasheet


Specifications

항목 내용
Target Protein spermatogenesis associated 19
Target Gene SPATA19
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
KHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031991 (70%), Rat ENSRNOG00000031438 (64%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
Recommended Application IHC
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.