CacheBy
Atlas Antibodies Anti-SPATA13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPATA13 Antibody

상품 한눈에 보기

인간 SPATA13 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, 토끼 유래 IgG로 제작됨. PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041208-100 Anti-SPATA13 Antibody, spermatogenesis associated 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041208-25 Anti-SPATA13 Antibody, spermatogenesis associated 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPATA13 Antibody

Anti-SPATA13 Antibody

Target Protein: spermatogenesis associated 13 (SPATA13)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human SPATA13.


Alternative Gene Names

  • ARHGEF29
  • FLJ31208

Open Datasheet (PDF)


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ALRPAEWGTLDGSDLEDTDDAFQRSTHRSRSLRRAYGLGRICLLDAPQNHATPTIATGQVPAVCEILVRDPENNSMGYRRSKSTDNLAFLKKSSFKRKSTSNLADLRTAH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000013707 54%
Mouse ENSMUSG00000021990 54%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.