CacheBy
Atlas Antibodies Anti-SPATA13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPATA13 Antibody

상품 한눈에 보기

인간 SPATA13 단백질에 대한 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 대해 검증되었으며, 보존용으로 글리세롤과 PBS 완충액을 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040185-100 Anti-SPATA13 Antibody, spermatogenesis associated 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040185-25 Anti-SPATA13 Antibody, spermatogenesis associated 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPATA13 Antibody

Anti-SPATA13 Antibody

Target Information

  • Target Protein: spermatogenesis associated 13
  • Target Gene: SPATA13
  • Alternative Gene Names: ARHGEF29, FLJ31208
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SPATA13.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ALRPAEWGTLDGSDLEDTDDAFQRSTHRSRSLRRAYGLGRICLLDAPQNHATPTIATGQVPAVCEILVRDPENNSMGYRRSKSTDNLAFLKKSSFKRKSTSNLADLRTAH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000013707 (54%)
  • Mouse ENSMUSG00000021990 (54%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Note Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Documents

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.